Anti-IDH1 antibody produced in rabbit ยี่ห้อ Sigma

PROPERTIES

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

packaging

antibody small pack of 25 μL

enhanced validation

RNAi knockdown

orthogonal RNAseq

Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL

immunohistochemistry: 1:500-1:1000

immunogen sequence

FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY

UniProt accession no.

O75874

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IDH1(3417)

DESCRIPTION

General description

1DH1 has a C-terminal peroxisomal targeting sequence and has two Rossmann fold units. It also possesses α /β sandwich structure and clasp domain further taking up staked parallel β-sheets fold.

The gene IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) is mapped to human chromosome 2q33. The protein is present in the cytoplasm and peroxisomes.[1]

Immunogen

isocitrate dehydrogenase 1 (NADP+), soluble recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-IDH1 antibody produced in rabbit has been used in western blotting.[2]

Anti-IDH1 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) participates in the TCA (tricarboxylic acid) cycle. It is responsible for the formation of α-ketoglutarate (αKG) by oxidative decarboxylation of isocitrate, thereby resulting in the generation of NADPH (nicotinamide adenine dinucleotide phosphate). IDH1 helps in glucose sensing, glutamine metabolism, lipogenesis and controlling cellular redox condition. In presence of hypoxia, it results in reductive carboxylation of αKG to form acetyl-CoA, which is needed for lipid synthesis. In mouse model, overexpression of the IDH1 gene causes obesity, fatty liver and hyperlipidemia. Mutations in this gene are associated with glioblastoma multiforme and acute myeloid leukemia.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

·       IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.

·       Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79089.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

SAFETY INFORMATION

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable